Interleukin-15, Active, Recombinant, Human, aa49-162 (IL15)

Catalog Number: USB-586955
Article Name: Interleukin-15, Active, Recombinant, Human, aa49-162 (IL15)
Biozol Catalog Number: USB-586955
Supplier Catalog Number: 586955
Alternative Catalog Number: USB-586955-10, USB-586955-50
Manufacturer: US Biological
Category: Molekularbiologie
Cytokine that stimulates the proliferation of T-lymphocytes. Stimulation by IL-15 requires interaction of IL-15 with components of IL-2R, including IL-2R beta and probably IL-2R gamma but not IL-2R alpha. Recombinant protein corresponding to aa49-162 from human Interleukin 15, expressed in E. coli. Molecular Weight: ~12.5kD Biological Activity: The ED50 as determined in a cell proliferation assay using CTLL?2 mouse cytotoxic T cells is less than 0.5 ng/ml. Amino Acid Sequence: NWVNVISDLKKIEDLIQSMHIDATLYTESDVHPSCKVTAMKCFLLELQVISLESGDASIHDTVENLIILANNSLSSNGNVTESGCKECEELEEKNIKEFLQSFVHIVQMFINTS Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Molecular Weight: 12.5
UniProt: P40933
Purity: 95% (SDS-PAGE) Endotoxin: 1EU/ug (LAL)
Form: Supplied as a lyophilized powder from PBS, pH 7.4. Reconstitute with sterile ddH2O, 0.1% BSA to a concentration of 0.1-1.0mg/ml.