Interleukin-23, Active, Recombinant, Human, His-Tag, aa20-189 & aa23-328 (IL-23)

Catalog Number: USB-586974
Article Name: Interleukin-23, Active, Recombinant, Human, His-Tag, aa20-189 & aa23-328 (IL-23)
Biozol Catalog Number: USB-586974
Supplier Catalog Number: 586974
Alternative Catalog Number: USB-586974-10, USB-586974-50
Manufacturer: US Biological
Category: Molekularbiologie
Associates with IL12B to form the IL-23 interleukin, a heterodimeric cytokine which functions in innate and adaptive immunity. IL-23 may constitute with IL-17 an acute response to infection in peripheral tissues. IL-23 binds to a heterodimeric receptor complex composed of IL12RB1 and IL23R, activates the Jak-Stat signaling cascade, stimulates memory rather than naive T-cells and promotes production of proinflammatory cytokines. IL-23 induces autoimmune inflammation and thus may be responsible for autoimmune inflammatory diseases and may be important for tumorigenesis. Recombinant protein corresponding to aa20-189 & aa23-328 from human Interleukin 23, fused to 6xHis-Tag at C-terminal, expressed in Mammalian cells. Molecular Weight: ~54.4kD Biological Activity: The ED50 as determined by its ability to binding IL23RA used funtional ELISA is less than 20ug/ml Amino Acid Sequence: RAVPGGSSPAWTQCQQLSQKLCTLAWSAHPLVGHMDLREEGDEETTNDVPHIQCGDGCDPQGLRDNSQFCLQRIHQGLIFYEKLLGSDIFTGEPSLLPDSPVGQLHASLLGLSQLLQPEGHHWETQQIPSLSPSQPWQRLLLRFKILRSLQAFVAVAARVFAHGAATLS & IWELKKDVYVVELDWYPDAPGEMVVLTCDTPEEDGITWTLDQSSEVLGSGKTLTIQVKEFGDAGQYTCHKGGEVLSHSLLLLHKKEDGIW STDILKDQKEPKNKTFLRCEAKNYSGRFTCWWLTTISTDLTFSVKSSRGSSDPQGVTCGAATLSAERVRGDNKEYEYSVECQEDSACPAAEESLPIEVMVDAVHKLKYENYTSSFFIRDIIKPDPPKNLQLKPLKNSRQVEVSWEYPDTWSTPHSYFSLTFCVQVQGKSKREKKDRVFTDKTSATVICRKNASISVRAQDRYYSSSWSEWASVPCS Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Molecular Weight: 54.4
UniProt: Q9NPF7
Purity: 95% (SDS-PAGE) Endotoxin: 1EU/ug (LAL)
Form: Supplied as a lyophilized powder from PBS, pH 7.4. Reconstitute with sterile ddH2O, 0.1% BSA to a concentration of 0.1-1.0mg/ml.