Interleukin-3, Active, Recombinant, Human, His-Tag, aa20-152 (IL3)

Catalog Number: USB-586976
Article Name: Interleukin-3, Active, Recombinant, Human, His-Tag, aa20-152 (IL3)
Biozol Catalog Number: USB-586976
Supplier Catalog Number: 586976
Alternative Catalog Number: USB-586976-10,USB-586976-50
Manufacturer: US Biological
Category: Molekularbiologie
Granulocyte/macrophage colony-stimulating factors are cytokines that act in hematopoiesis by controlling the production, differentiation, and function of 2 related white cell populations of the blood, the granulocytes and the monocytes-macrophages. Recombinant protein corresponding to aa20-152 from human Interleukin 3, fused to 6xHis-Tag at C-terminal, expressed in Mammalian cells. Molecular Weight: ~16.1kD Biological Activity: The ED50 as determined in a cell proliferation assay using TF?1 human erythroleukemic cells is less than 2ng/ml. Amino Acid Sequence: APMTQTTPLKTSWVNCSNMIDEIITHLKQPPLPLLDFNNLNGEDQDILMENNLRRPNLEAFNRAVKSLQNASAIESILKNLLPCLPLATAAPTRHPIHIKDGDWNEFRRKLTFYLKTLENAQAQQTTLSLAIF Storage and Stability: Lyophilized and reconstituted products are stable for 12 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Molecular Weight: 16.1
UniProt: P08700
Purity: 95% (SDS-PAGE) Endotoxin: 1EU/ug (LAL)
Form: Supplied as a lyophilized powder from PBS, pH 7.4. Reconstitute with sterile ddH2O, 0.1% BSA to a concentration of 0.1-1.0mg/ml.