Participates in at least several B-cell activation processes as well as of other cell types. Recombinant protein corresponding to aa21-140 from mouse Interleukin 4, fused to 6xHis-Tag at C-terminal, expressed in Mammalian cells. Molecular Weight: ~14.6kD Biological Activity: Measured in a cell proliferation assay using M-NFS-60 mouse lymphoblast cells. The ED50 for this effect is 0.035ng/ml. Amino Acid Sequence: HIHGCDKNHLREIIGILNEVTGEGTPCTEMDVPNVLTATKNTTESELVCRASKVLRIFYLKHGKTPCLKKNSSVLMELQRLFRAFRCLDSSISCTMNESKSTSLKDFLESLKSIMQMDYS Storage and Stability: Lyophilized and reconstituted products are stable for 12 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
