Interleukin-7, Active, Recombinant, Human, aa30-212 (IL7)(GMP)

Catalog Number: USB-586997
Article Name: Interleukin-7, Active, Recombinant, Human, aa30-212 (IL7)(GMP)
Biozol Catalog Number: USB-586997
Supplier Catalog Number: 586997
Alternative Catalog Number: USB-586997-5,USB-586997-100
Manufacturer: US Biological
Category: Molekularbiologie
Hematopoietic growth factor capable of stimulating the proliferation of lymphoid progenitors. It is important for proliferation during certain stages of B-cell maturation. Partial recombinant protein corresponding to aa26-177 from human Interleukin-4, expressed in E. coli. Molecular Weight: ~17.4kD Biological Activity: Fully biologically active when compared to standard. The ED50 as determined by a cell proliferation assay using murine 2E8 cells is less than 0.5ng/ml, corresponding to a specific activity of >2.0*106IU/mg. Amino Acid Sequence: DCDIEGKDGKQYESVLMVSIDQLLDSMKEIGSNCLNNEFNFFKRHICDANKEGMFLFRAARKLRQFLKMNSTGDFDLHLLKVSEGTTILLNCTGQVKGRKPAALGEAQPTKSLEENKSLKEQKKLNDLCFLKRLLQEIKTCWNKILMGTKEH Storage and Stability: Lyophilized and reconstituted products are stable for 12 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Molecular Weight: 17.4
UniProt: P13232
Purity: 98% (SDS-PAGE and HPLC) Endotoxin: 1EU/ug
Form: Supplied as a lyophilized powder from PBS, pH 7.4. Reconstitute with sterile ddH2O, 0.1% BSA to a concentration of 0.1-1mg/ml.