Supports IL-2 independent and IL-4 independent growth of helper T-cells. Recombinant protein corresponding to aa19-144 from human Interleukin 9, fused to 6xHis-Tag at C-terminal, expressed in Mammalian cells. Molecular Weight: ~15.16 kD Biological Activity: The ED50 as determined in a cell proliferation assay using MO7e human megakaryocytic leukemic cells is typically less than 0.5 ng/ml Amino Acid Sequence: QGCPTLAGILDINFLINKMQEDPASKCHCSANVTSCLCLGIPSDNCTRPCFSERLSQMTNTTMQTRYPLIFSRVKKSVEVLKNNKCPYFSCEQPCNQTTAGNALTFLKSLLEIFQKEKMRGMRGKI Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
