Interleukin-9, Active, Recombinant, Human, His-Tag, aa19-144 (IL9)

Catalog Number: USB-587002
Article Name: Interleukin-9, Active, Recombinant, Human, His-Tag, aa19-144 (IL9)
Biozol Catalog Number: USB-587002
Supplier Catalog Number: 587002
Alternative Catalog Number: USB-587002-10,USB-587002-50
Manufacturer: US Biological
Category: Molekularbiologie
Supports IL-2 independent and IL-4 independent growth of helper T-cells. Recombinant protein corresponding to aa19-144 from human Interleukin 9, fused to 6xHis-Tag at C-terminal, expressed in Mammalian cells. Molecular Weight: ~15.16 kD Biological Activity: The ED50 as determined in a cell proliferation assay using MO7e human megakaryocytic leukemic cells is typically less than 0.5 ng/ml Amino Acid Sequence: QGCPTLAGILDINFLINKMQEDPASKCHCSANVTSCLCLGIPSDNCTRPCFSERLSQMTNTTMQTRYPLIFSRVKKSVEVLKNNKCPYFSCEQPCNQTTAGNALTFLKSLLEIFQKEKMRGMRGKI Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Molecular Weight: 15.16
UniProt: P15248
Purity: 95% (SDS-PAGE) Endotoxin: 1EU/ug (LAL)
Form: Supplied as a lyophilized powder from PBS, pH 7.4. Reconstitute with sterile ddH2O, 0.1% BSA to a concentration of 0.1-1.0mg/ml.