Leukemia Inhibitory Factor, Active, Recombinant, Human, aa23-202 (LIF)

Catalog Number: USB-587006
Article Name: Leukemia Inhibitory Factor, Active, Recombinant, Human, aa23-202 (LIF)
Biozol Catalog Number: USB-587006
Supplier Catalog Number: 587006
Alternative Catalog Number: USB-587006-10,USB-587006-50
Manufacturer: US Biological
Category: Molekularbiologie
LIF has the capacity to induce terminal differentiation in leukemic cells. Its activities include the induction of hematopoietic differentiation in normal and myeloid leukemia cells, the induction of neuronal cell differentiation, and the stimulation of acute-phase protein synthesis in hepatocytes. Recombinant protein corresponding to aa23-202 from human Leukemia inhibitory factor, expressed in E.coli. Molecular Weight: ~19.7kD Biological Activity: The ED50 as determined by the M1 cell differentiation assay is less than 0.8ng/ml Amino Acid Sequence: SPLPITPVNATCAIRHPCHNNLMNQIRSQLAQLNGSANALFILYYTAQGEPFPNNLDKLCGPNVTDFPPFHANGTEKAKLVELYRIVVYLGTSLGNITRDQKILNPSALSLHSKLNATADILRGLLSNVLCRLCSKYHVGHVDVTYGPDTSGKDVFQKKKLGCQLLGKYKQIIAVLAQAF Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Molecular Weight: 19.7
UniProt: P15018
Purity: 95% (SDS-PAGE) Endotoxin: 1EU/ug (LAL)
Form: Supplied as a lyophilized powder from 20mM PBS, pH 7.4, 0.02% Tween 20. Reconstitute with sterile ddH2O, to a concentration of 0.1-1mg/ml.