Platelet Basic Protein, Active, Recombinant, Human, aa59-128 (PPBP)

Catalog Number: USB-587021
Article Name: Platelet Basic Protein, Active, Recombinant, Human, aa59-128 (PPBP)
Biozol Catalog Number: USB-587021
Supplier Catalog Number: 587021
Alternative Catalog Number: USB-587021-10,USB-587021-50
Manufacturer: US Biological
Category: Molekularbiologie
LA-PF4 stimulates DNA synthesis, mitosis, glycolysis, intracellular cAMP accumulation, prostaglandin E2 secretion, and synthesis of hyaluronic acid and sulfated glycosaminoglycan. It also stimulates the formation and secretion of plasminogen activator by human synovial cells. NAP-2 is a ligand for CXCR1 and CXCR2, and NAP-2, NAP-2(73), NAP-2(74), NAP-2(1-66), and most potent NAP-2(1-63) are chemoattractants and activators for neutrophils. TC-1 and TC-2 are antibacterial proteins, in vitro released from activated platelet alpha-granules. CTAP-III(1-81) is more potent than CTAP-III desensitize chemokine-induced neutrophil activation. Partial recombinant protein corresponding to aa59-128 from human Platelet basic protein, expressed in E. coli. Molecular Weight: ~7.6kD Biological Activity: The ED50 as determined by its ability to activate chimeric receptor and induce reporter gene expression in HEK293 cell line used Splite TEV activity detection platform is typically 18ng/mL. Amino Acid Sequence: AELRCMCIKTTSGIHPKNIQSLEVIGKGTHCNQVEVIATLKDGRKICLDPDAPRIKKIVQKKLAGDESAD Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
Molecular Weight: 7.6
UniProt: P02775
Purity: 95% (SDS-PAGE) Endotoxin: 1EU/ug (LAL)
Form: Supplied as a lyophilized powder from PBS, pH 7.4. Reconstitute with sterile ddH2O, to a concentration of 0.1-1mg/ml.