Platelet-derived Growth Factor Subunit B, Active, Recombinant, Mouse, His-Tag, aa82-190 (Pdgfb)

Catalog Number: USB-587024
Article Name: Platelet-derived Growth Factor Subunit B, Active, Recombinant, Mouse, His-Tag, aa82-190 (Pdgfb)
Biozol Catalog Number: USB-587024
Supplier Catalog Number: 587024
Alternative Catalog Number: USB-587024-10,USB-587024-50
Manufacturer: US Biological
Category: Molekularbiologie
Growth factor that plays an essential role in the regulation of embryonic development, cell proliferation, cell migration, survival and chemotaxis. Potent mitogen for cells of mesenchymal origin. Required for normal proliferation and recruitment of pericytes and vascular smooth muscle cells in the central nervous system, skin, lung, heart and placenta. Required for normal blood vessel development, and for normal development of kidney glomeruli. Plays an important role in wound healing. Signaling is modulated by the formation of heterodimers with PDGFA. Recombinant protein corresponding to aa82-190 from mouse Platelet-derived growth factor subunit B, fused to 6X His-Tag at C-terminal, expressed in E.coli. Molecular Weight: ~13.4kD Biological Activity: The ED50 as determined in a cell proliferation assay using BALB/c 3T3 cells is less than 40ng/ml. Amino Acid Sequence: SLGSLAAAEPAVIAECKTRTEVFQISRNLIDRTNANFLVWPPCVEVQRCSGCCNNRNVQCRASQVQMRPVQVRKIEIVRKKPIFKKATVTLEDHLACKCETIVTPRPVT Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Molecular Weight: 13.4
UniProt: P31240
Purity: 95% (SDS-PAGE) Endotoxin: 1EU/ug (LAL)
Form: Supplied as a lyophilized powder from 4mM HCl. Reconstitute with sterile ddH2O, to a concentration of 0.1-1mg/ml.