Platelet-derived Growth Factor Subunit B. Active, Recombinant, Human, aa82-190 (PDGFB)
Biozol Catalog Number:
USB-587025
Supplier Catalog Number:
587025
Alternative Catalog Number:
USB-587025-10,USB-587025-50
Manufacturer:
US Biological
Category:
Molekularbiologie
Growth factor that plays an essential role in the regulation of embryonic development, cell proliferation, cell migration, survival and chemotaxis. Potent mitogen for cells of mesenchymal origin Recombinant protein corresponding to aa82-190 from human Platelet-derived growth factor subunit B, expressed in E.coli. Molecular Weight: ~12.42kD Biological Activity: Measured in a cell proliferation assay using BALB/c 3T3 cells.The ED50 for this effect is 15-60ng/ml. Amino Acid Sequence: SLGSLTIAEPAMIAECKTRTEVFEISRRLIDRTNANFLVWPPCVEVQRCSGCCNNRNVQCRPTQVQLRPVQVRKIEIVRKKPIFKKATVTLEDHLACKCETVAAARPVT Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
