Pro-epidermal Growth Factor, Active, Recombinant, Mouse, His-Tag, aa977-1029 (Egf)

Catalog Number: USB-587028
Article Name: Pro-epidermal Growth Factor, Active, Recombinant, Mouse, His-Tag, aa977-1029 (Egf)
Biozol Catalog Number: USB-587028
Supplier Catalog Number: 587028
Alternative Catalog Number: USB-587028-10,USB-587028-50,USB-587028-500,USB-587028-1
Manufacturer: US Biological
Category: Molekularbiologie
EGF stimulates the growth of various epidermal and epithelial tissues in vivo and in vitro and of some fibroblasts in cell culture. Magnesiotropic hormone that stimulates magnesium reabsorption in the renal distal convoluted tubule via engagement of EGFR and activation of the magnesium channel TRPM6 (By similarity). Partial recombinant protein corresponding to aa977-1029 from mouse Pro-epidermal growth factor, fused to 6X His-Tag at C-terminal, expressed in E. coli. Accession/Uniprot: P01132 Molecular Weight: ~7.2kD Biological Activity: The ED50 as determined in a cell proliferation assay using BALB/c 3T3 cells is less than 5ng/ml. Amino Acid Sequence: NSYPGCPSSYDGYCLNGGVCMHIESLDSYTCNCVIGYSGDRCQTRDLRWWELR Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Molecular Weight: 7.2
UniProt: P01132
Purity: 95% (SDS-PAGE) Endotoxin: 1EU/ug (LAL)
Form: Supplied as a lyophilized powder from PBS, pH 7.4. Reconstitute with sterile ddH2O, to a concentration of 0.1-1mg/ml.