Pro-neuregulin-1, Membrane-bound isoform, Active, Recombinant, Human, aa177-241 (NRG1)

Catalog Number: USB-587030
Article Name: Pro-neuregulin-1, Membrane-bound isoform, Active, Recombinant, Human, aa177-241 (NRG1)
Biozol Catalog Number: USB-587030
Supplier Catalog Number: 587030
Alternative Catalog Number: USB-587030-10,USB-587030-50
Manufacturer: US Biological
Category: Molekularbiologie
Direct ligand for ERBB3 and ERBB4 tyrosine kinase receptors. Concomitantly recruits ERBB1 and ERBB2 coreceptors, resulting in ligand-stimulated tyrosine phosphorylation and activation of the ERBB receptors. The multiple isoforms perform diverse functions such as inducing growth and differentiation of epithelial, glial, neuronal, and skeletal muscle cells, inducing expression of acetylcholine receptor in synaptic vesicles during the formation of the neuromuscular junction, stimulating lobuloalveolar budding and milk production in the mammary gland and inducing differentiation of mammary tumor cells, stimulating Schwann cell proliferation, implication in the development of the myocardium such as trabeculation of the developing heart. Isoform 10 may play a role in motor and sensory neuron development. Binds to ERBB4. Partial recombinant protein corresponding to aa177-241 from human Pro-neuregulin-1, expressed in Mammalian cells. Molecular Weight: ~7.5kD Biological Activity: The ED50 as determined in a serum-free cell proliferation assay using MCF?7 human breast cancer cells is less than 3ng/ml. Amino Acid Sequence: SHLVKCAEKEKTFCVNGGECFMVKDLSNPSRYLCKCPNEFTGDRCQNYVMASFYKHLGIEFMEAE Storage and Stability: Lyophilized and reconstituted products are stable for 12 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Molecular Weight: 7.5
UniProt: Q02297
Purity: 95% (SDS-PAGE) Endotoxin: 1EU/ug (LAL)
Form: Supplied as a lyophilized powder from PBS, pH 7.4. Reconstitute with sterile ddH2O, 0.1% BSA to a concentration of 0.1-1.0mg/ml.