Regulator of G-protein Signaling 17, Active, Recombinant, Human, GST-Tag, aa1-210 (RGS17)

Catalog Number: USB-587035
Article Name: Regulator of G-protein Signaling 17, Active, Recombinant, Human, GST-Tag, aa1-210 (RGS17)
Biozol Catalog Number: USB-587035
Supplier Catalog Number: 587035
Alternative Catalog Number: USB-587035-20,USB-587035-100,USB-587035-1
Manufacturer: US Biological
Category: Molekularbiologie
Regulates G protein-coupled receptor signaling cascades, including signaling via muscarinic acetylcholine receptor CHRM2 and dopamine receptor DRD2. Inhibits signal transduction by increasing the GTPase activity of G protein alpha subunits, thereby driving them into their inactive GDP-bound form. Recombinant protein corresponding to aa1-210 from Regulator of G-protein signaling 17, fused to GST-Tag at N-terminal, expressed in E.coli. Molecular Weight: ~51.4kD Biological Activity: Measured by its binding ability in a functional ELISA. Immobilized AQP1 at 2ug/ml can bind human RGS17, the EC50 of human RGS17 protein is 31.63-34.44ug/ml. Amino Acid Sequence: MRKRQQSQNEGTPAVSQAPGNQRPNNTCCFCWCCCCSCSCLTVRNEERGENAGRPTHTTKMESIQVLEECQNPTAEEVLSWSQNFDKMMKAPAGRNLFREFLRTEYSEENLLFWLACEDLKKEQNKKVIEEKARMIYEDYISILSPKEVSLDSRVREVINRNLLDPNPHMYEDAQLQIYTLMHRDSFPRFLNSQIYKSFVESTAGSSSES Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
Molecular Weight: 51.4
UniProt: Q9UGC6
Purity: 85% (SDS-PAGE)
Form: Supplied as a lyophilized powder from human Tris-HCl, 50% glycerol. Reconstitute with sterile ddH2O, 0.1% BSA to a concentration of 0.1-1mg/ml.