Cell surface proteoglycan that bears heparan sulfate. Regulates dendritic arbor morphogenesis (By similarity). Partial recombinant protein corresponding to aa19-144 from human Syndecan-2, fused to 6xHis-Tag at C-terminal, expressed in Mammalian cells. Molecular Weight: ~14.98kD Biological Activity: The ED50 as determined by its ability to bind human FGFb in functional ELISA is less than 5ug/ml. Amino Acid Sequence: ESRAELTSDKDMYLDNSSIEEASGVYPIDDDDYASASGSGADEDVESPELTTSRPLPKILLTSAAPKVETTTLNIQNKIPAQTKSPEETDKEKVHLSDSERKMDPAEEDTNVYTEKHSDSLFKRTE Storage and Stability: Lyophilized and reconstituted products are stable for 12 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Supplied as a lyophilized powder from 20mM Tris-Citrate, pH 7.0, 150mM sodium chloride. Reconstitute with sterile ddH2O, 0.1% BSA to a concentration of 0.1-1.0mg/ml.
* VAT and and shipping costs not included. Errors and price changes excepted
