Transforming Growth Factor beta-1, Active, Recombinant, Mouse, aa279-390 (Tgfb1)

Catalog Number: USB-587045
Article Name: Transforming Growth Factor beta-1, Active, Recombinant, Mouse, aa279-390 (Tgfb1)
Biozol Catalog Number: USB-587045
Supplier Catalog Number: 587045
Alternative Catalog Number: USB-587045-10,USB-587045-50
Manufacturer: US Biological
Category: Molekularbiologie
Multifunctional protein that controls proliferation, differentiation and other functions in many cell types. Many cells synthesize TGFB1 and have specific receptors for it. It positively and negatively regulates many other growth factors. It plays an important role in bone remodeling as it is a potent stimulator of osteoblastic bone formation, causing chemotaxis, proliferation and differentiation in committed osteoblasts Partial recombinant protein corresponding to aa279-390 from mouse Transforming growth factor beta-1, expressed in Mammalian cell. Swiss/Uniprot Accession: P04202 Molecular Weight: ~12.8kD Biological Activity: The ED50 as determined by its ability to inhibit IL-4-dependent proliferation of TF-1 human erythroleukemic cells is 5-25pg/ml. Amino Acid Sequence: ALDTNYCFSSTEKNCCVRQLYIDFRKDLGWKWIHEPKGYHANFCLGPCPYIWSLDTQYSKVLALYNQHNPGASASPCCVPQALEPLPIVYYVGRKPKVEQLSNMIVRSCKCS Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Molecular Weight: 12.8
UniProt: P04202
Purity: 95%
Form: Supplied as a lyophilized powder from 4mM HCl. Reconstitute with sterile ddH2O, to a concentration of 0.1-1mg/ml.