Tumor-associated Calcium Signal Transducer 2, Active, Recombinant, Human, aa27-274 (TACSTD2)

Catalog Number: USB-587071
Article Name: Tumor-associated Calcium Signal Transducer 2, Active, Recombinant, Human, aa27-274 (TACSTD2)
Biozol Catalog Number: USB-587071
Supplier Catalog Number: 587071
Alternative Catalog Number: USB-587071-20,USB-587071-100
Manufacturer: US Biological
Category: Molekularbiologie
May function as a growth factor receptor. Partial recombinant protein corresponding to aa27-274 from Somatotropin, fused to hFc-Tag at C-terminal, expressed in Mammalian cells. Molecular Weight: ~56.8kD Biological Activity: Measured in cell activity assay using U937 cells. The EC50 for this effect is 190.2-298.6ng/ml. Amino Acid Sequence: HTAAQDNCTCPTNKMTVCSPDGPGGRCQCRALGSGMAVDCSTLTSKCLLLKARMSAPKNARTLVRPSEHALVDNDGLYDPDCDPEGRFKARQCNQTSVCWCVNSVGVRRTDKGDLSLRCDELVRTHHILIDLRHRPTAGAFNHSDLDAELRRLFRERYRLHPKFVAAVHYEQPTIQIELRQNTSQKAAGDVDIGDAAYYFERDIKGESLFQGRGGLDLRVRGEPLQVERTLIYYLDEIPPKFSMKRLT Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
Molecular Weight: 56.8
UniProt: P09758
Purity: 90% (SDS-PAGE) Endotoxin: 1EU/ug
Form: Supplied as a lyophilized powder from PBS, pH 7.4, 6% Trehalose. Reconstitute with sterile ddH2O, 0.1% BSA to a concentration of 0.1-1mg/ml.