Complement fragment C5a is a 74-residu glycopolypeptide which is generated by proteolytic cleavage of the complement factor C5 in the course of complement activation. C5a is a potent chemoattractant and anaphylatoxin that acts on all classes of leukocytes and on many other cell types including endothelial, smooth muscle, kidney, liver, and neural cells. In addition to its proinflammatory effects, C5a has been shown to protect cells against toxic insult and to stimulate proliferation in neurons and hepatocytes, suggesting a wider role for C5a in homeostasis. C5a is rapidly desarginated by serum carboxypeptidase N to the less potent derivate C5a desArg, the first stage in deactivation of anaphylatoxin activity. The C5a desArg form has a different spectrum of bioactivity to intact C5a. Recombinant protein corresponding to human C5a desArg, fused to 6xHis-Tag, expressed in E. coli. Amino Acid Sequence: MRGSHHHHHHGSDYDIPTTENLYFQGGSTLQKKIEEIAAKYKHSVVKKCCYDGACVNNDETCEQ RAARISLGPRCIKAFTECCVVASQLRANISHKDMQLG Storage and Stability: Lyophilized and reconstituted products may be stored at -20C. Stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Purity:
Purified
Form:
Supplied as a lyophilized powder from 0.1M Tris-Cl, pH 8.0, 0.005% Tween 80, 2mM reduced L-glutathion, 0.2mM oxidized L-glutathion. Reconstitute with 500ul sterile ddH2O.
* VAT and and shipping costs not included. Errors and price changes excepted