Lymphotoxin beta Receptor, Recombinant, Murine/Human IgG1 Fc Fusion Protein (LTBR, LT-beta-R, Tumor Necrosis Factor C Receptor, Tumor Necrosis Factor Receptor Superfamily Member 3) (Preservative Free)
Biozol Catalog Number:
USB-L8015-04
Supplier Catalog Number:
L8015-04
Alternative Catalog Number:
USB-L8015-04-100
Manufacturer:
US Biological
Category:
Molekularbiologie
A soluble fusion protein consisting of 10 residual amino acids from murine CD8 alpha leader sequence (KPQAPELRGS), followed by the mature extracellular domain of murine LTbR (aa 28-221) fused to human IgG1 Fc. Molecular weight: 48.8kD. This protein runs at a higher apparent MW by SDS-PAGE due to glycosylation. Amino Acid Sequence: KPQAPELRGSSQPQLVPPYRIENQTCWDQDKEYYEPMHDVCCSRCPPGEFVFAVCSRSQDTVCKTCPHNSYNEHWNHLSTCQLCRPCDIVLGFEEVAPCTSDRKAECRCQPGMSCVYLDNECVHCEEERLVLCQPGTEAEVTDEIMDTDVNCVPCKPGHFQNTSSPRARCQPHTRCEIQGLVEAAPGTSYSDTICKNPPEPGAMPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSRDELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK Mouse CD8 signal peptide and linker: KPQAPELRGS Mouse LTBR (a.a. 28-221): SQPQL......EPGAM Fc of human IgG1, Accession P01857 (a.a.100-330): PKSCD....LSPGK Transfectant Cell Line: HEK293 Applications: Suitable for the use in the study of enzyme kinetics, screening inhibitors and selectively profiling. Other applications not tested. Recommended Dilutions: Optimal dilutions to be determined by the researcher. Storage and Stability: Aliquot to avoid repeated freezing and thawing and store at -70C. Aliquots are stable for 6 months after receipt. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.