PDKtide (Biotin)

Catalog Number: USB-P3123-76A
Article Name: PDKtide (Biotin)
Biozol Catalog Number: USB-P3123-76A
Supplier Catalog Number: P3123-76A
Alternative Catalog Number: USB-P3123-76A-1
Manufacturer: US Biological
Category: Molekularbiologie
Amino Acid Sequence: [protein fragment, 39 aa] Labeled with Biotin (linear) Molecular Formula: C222H328N56O68S4 Molecular Weight: 4997.66 Purity: 80% Form: Supplied as a lyophilized powder Storage and Stability: Lyophilized powder may be stored at 4C for short-term only. Stable for 6 months after receipt at -20C. Reconstitute (see reconstitution instructions for peptides) and store at -20C. For maximum recovery of product, centrifuge the original vial prior to removing the cap.
Molecular Weight: 4997.66