Phospholipase A2, Secretory, Group IID, Recombinant, Human (PLA2, sPLA2-IID)

Catalog Number: USB-P4074-06E5
Article Name: Phospholipase A2, Secretory, Group IID, Recombinant, Human (PLA2, sPLA2-IID)
Biozol Catalog Number: USB-P4074-06E5
Supplier Catalog Number: P4074-06E5
Alternative Catalog Number: USB-P4074-06E5-10
Manufacturer: US Biological
Category: Molekularbiologie
Phospholipase A2 (PLA2) catalyzes the hydrolysis of the sn-2 position of membrane glycerophospholipids to liberate arachidonic acid (AA), a precursor of eicosanoids including prostaglandins and leukotrienes. The same reaction also produces lysophosholipids, which represent another class of lipid mediators. The secretory PLA2 (sPLA2) family, in which 10 isozymes have been identified, consists of lowmolecular weight, Ca2+-requiring secretory enzymes that have been implicated in a number of biological processes, such as modification of eicosanoid generation, inflammation, and host defense. This enzyme has been proposed to hydrolyze phosphatidylcholine (PC) in lipoproteins to liberate lyso- PC and free fatty acids in the arterial wall, thereby facilitating the accumulation of bioactive lipids and modified lipoproteins in atherosclerotic foci. In mice, sPLA2 expression significantly influences HDL particle size and composition and demonstrate that an induction of sPLA2 is required for the decrease in plasma HDL cholesterol in response to inflammatory stimuli. Instillation of bacteria into the bronchi was associated with surfactant degradation and a decrease in large:small ratio of surfactant aggregates in rats. Recombinant Human Secreted Phospholipase A2-IID was produced with N-terminal His-Tag. Recombinant Human Secreted Phospholipase A2-IID is 16.4kD containing 125 amino acid residues of the human secreted phospholipase A2-IID and 16 additional amino acid residues . Amino Acid Sequence: MRGSHHHHHHGMASHMGILNLNKMVKQVTGKMPILSYWPYGCHCGLGGRGQPKDATDWCCQ THDCCYDHLKTQGCGIYKYYRYNFSQGNIHCSDKGSWCEQQLCACDKEVAFCLKRNLDTYQKRLR FYWRPHCRGQTPGC Applications: Suitable for use in Western Blot. Other applications not tested. Recommended Dilutions: Optimal dilutions to be determined by the researcher. Reconstitution: Add 0.2 ml of 0.1M Acetate buffer pH4 and let the lyophilized pellet dissolve completely. For conversion into higher pH value, we recommend intensive dilution by relevant buffer to a concentration of 10 g/ml. In higher concentrations the solubility of this antigen is limited. Storage and Stability: Lyophilized powder may be stored at -20C. Stable for 12 months after receipt at -20C. Reconstitute with 0.1M Acetate buffer, pH 4. Aliquot and store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Molecular Weight: 16.4
UniProt: Q9UNK4
Purity: 95% (SDS-PAGE), Ni-NTA affinity chromatography.
Form: Supplied as a lyophilized powder in 0.05M acetate buffer, pH 4.0.