Topoisomerase I (DNA Topoisomerase 1, DNA Topoisomerase I, NUP98 Fusion Gene, TOP 1, TOP1, TOP-1, TOP I, TOPI, TOP-I, Topoisomerase (DNA) I, Topoisomerase 1, Topoisomerase1, Topoisomerase-1, Topoisomerase-I, Type I DNA Topoisomera
Topoisomerase I (DNA Topoisomerase 1, DNA Topoisomerase I, NUP98 Fusion Gene, TOP 1, TOP1, TOP-1, TOP I, TOPI, TOP-I, Topoisomerase (DNA) I, Topoisomerase 1, Topoisomerase1, Topoisomerase-1, Topoisomerase-I, Type I DNA Topoisomera
Topoisomerase I (DNA Topoisomerase 1, DNA Topoisomerase I, NUP98 Fusion Gene, TOP 1, TOP1, TOP-1, TOP I, TOPI, TOP-I, Topoisomerase (DNA) I, Topoisomerase 1, Topoisomerase1, Topoisomerase-1, Topoisomerase-I, Type I DNA Topoisomera
Biozol Catalog Number:
USB-T8064-99D-HRP
Supplier Catalog Number:
T8064-99D-HRP
Alternative Catalog Number:
USB-T8064-99D-HRP-100
Manufacturer:
US Biological
Host:
Mouse
Category:
Antikörper
Application:
ELISA, IHC, WB
Immunogen:
Partial recombinant protein corresponding to aa692-765 from human TOP1 with GST tag. MW of GST tag alone is 26kD.
This gene encodes a DNA topoisomerase, an enzyme that controls and alters the topologic states of DNA during transcription. This enzyme catalyzes the transient breaking and rejoining of a single strand of DNA which allows the strands to pass through one another, thus altering the topology of DNA. This gene is localized to chromosome 20 and has pseudogenes which reside on chromosomes 1 and 22. [provided by RefSeq] Applications: Suitable for use in ELISA, Western Blot and Immunohistochemistry. Other applications not tested. Recommended Dilutions: Immunohistochemistry: Paraffin sections Optimal dilutions to be determined by the researcher. Amino Acid Sequence: QRLEEQLMKLEVQATDREENKQIALGTSKLNYLDPRITVAWCKKWGVPIEKIYNKTQREKFAWAIDMADEDYEF Storage and Stability: Store product at 4C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20C. Aliquots are stable at -20C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Note: Sodium azide is a potent inhibitor of peroxidase and should not be added to HRP conjugates. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Note: Applications are based on unconjugated antibody.
