TRAIL Receptor 3 (TRAIL R3, TNF-Related Apoptosis Inducing Receptor3), Goat

Catalog Number: USB-T8181-16
Article Name: TRAIL Receptor 3 (TRAIL R3, TNF-Related Apoptosis Inducing Receptor3), Goat
Biozol Catalog Number: USB-T8181-16
Supplier Catalog Number: T8181-16
Alternative Catalog Number: USB-T8181-16-100,USB-T8181-16-200
Manufacturer: US Biological
Host: Goat
Category: Antikörper
Application: ELISA, FC, IHC, WB
Immunogen: Synthetic peptide corresponding to aa33-63, EVPQQTVAPQQQRHSFKGEECPAGSHRSEHTC, from the extracellular domain sequence of human TRAIL-R3.
TRAIL (also known as Apo-2L) is a member of the tumor necrosis factor (TNF) ligand family that rapidly induces apoptosis in a variety of transformed cell lines. A distinct receptor for TRAIL, TRAIL-R3, is restricted to peripheral blood lymphocytes (PBLs) and skeletal muscle. All three TRAIL receptors bind TRAIL with similar affinity, suggesting a complex regulation of TRAIL-mediated signals. Applications: Suitable for use in Flow Cytometry, ELISA, Western Blot and Immunohistochemistry. Other applications not tested. Recommended Dilution: ELISA: 1:25,000 Western Blot: 1:150 Immunohistochemistry (paraffin): 1:25 Flow Cytometry: 2ul per 10e6 cells in 100ul Optimal dilutions to be determined by the researcher. Storage and Stability: May be stored at 4C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20C. Aliquots are stable for 12 months after receipt. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
NCBI: 003801
UniProt: O14798
Purity: Purified by affinity chromatography.
Form: Supplied as a liquid in PBS, pH 7.2, 1mg/ml BSA, 0.09% sodium azide.