Troponin C (Troponin C, slow skeletal and cardiac muscles, TN-C, TNNC1, TNNC) (Azide Free), Clone: [11C911], Mouse, Monoclonal

Catalog Number: USB-T8665-01D
Article Name: Troponin C (Troponin C, slow skeletal and cardiac muscles, TN-C, TNNC1, TNNC) (Azide Free), Clone: [11C911], Mouse, Monoclonal
Biozol Catalog Number: USB-T8665-01D
Supplier Catalog Number: T8665-01D
Alternative Catalog Number: USB-T8665-01D-100
Manufacturer: US Biological
Host: Mouse
Category: Antikörper
Application: ELISA, IHC, WB
Immunogen: Full-length recombinant corresponding aa1-161 of human Troponin c with a GST tag. The MW of the GST tag alone is 26kD.
Troponin is a central regulatory protein of striated muscle contraction, and together with tropomyosin, is located on the actin filament. Troponin consists of 3 subunits: TnI, which is the inhibitor of actomyosin ATPase, TnT, which contains the binding site for tropomyosin, and TnC, the protein encoded by this gene. The binding of calcium to TnC abolishes the inhibitory action of TnI, thus allowing the interaction of actin with myosin, the hydrolysis of ATP, and the generation of tension. Mutations in this gene are associated with cardiomyopathy dilated type 1Z. Applications: Suitable for use in ELISA, Immunohistochemistry and Western Blot. Other applications not tested. Recommended Dilutions: Immunohistochemistry (FFPE): 3ug/ml Optimal dilutions to be determined by the researcher. Amino Acid Sequence: MDDIYKAAVEQLTEEQKNEFKAAFDIFVLGAEDGCISTKELGKVMRMLGQNPTPEELQEMIDEVDEDGSGTVDFDEFLVMMVRCMKDDSKGKSEEELSDLFRMFDKNADGYIDLDELKIMLQATGETITEDDIEELMKDGDKNNDGRIDYDEFLEFMKGVE Storage and Stability: May be stored at 4C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20C. Aliquots are stable for 12 months after receipt. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
Clonality: Monoclonal
Clone Designation: [11C911]
NCBI: 30244
Purity: Purified by Protein A affinity chromatography.
Form: Supplied as a liquid in PBS, pH 7.4. No preservative added (Azide free).