TSG101 (Tumor Susceptibility Gene 101 Protein, ESCRT-I Complex Subunit TSG101), Clone: [5B7], Mouse, Monoclonal

Catalog Number: USB-T9101-75C
Article Name: TSG101 (Tumor Susceptibility Gene 101 Protein, ESCRT-I Complex Subunit TSG101), Clone: [5B7], Mouse, Monoclonal
Biozol Catalog Number: USB-T9101-75C
Supplier Catalog Number: T9101-75C
Alternative Catalog Number: USB-T9101-75C-100
Manufacturer: US Biological
Host: Mouse
Category: Antikörper
Application: ELISA, IF, IHC, WB
Immunogen: Partial recombinant protein corresponding to aa 201-280 from human TSG101 with GST tag. MW of the GST tag alone is 26kD.
TSG101 belongs to a group of apparently inactive homologs of ubiquitin-conjugating enzymes. The gene product contains a coiled-coil domain that interacts with stathmin, a cytosolic phosphoprotein implicated in tumorigenesis. The protein may play a role in cell growth and differentiation and act as a negative growth regulator. In vitro steady-state expression of this tumor susceptibility gene appears to be important for maintenance of genomic stability and cell cycle regulation. Mutations and alternative splicing in this gene occur in high frequency in breast cancer and suggest that defects occur during breast cancer tumorigenesis and/or progression. Applications: Suitable for use in ELISA, Immunohistochemistry, Immunofluorescence and Western Blot. Other applications not tested. Recommended Dilutions: Immunohistochemistry (Paraffin): 3ug/ml Immunofluorescence: 10ug/ml Optimal dilutions to be determined by the researcher. Amino Acid Sequence: SSQYPSQPPVTTVGPSRDGTISEDTIRASLISAVSDKLRWRMKEEMDRAQAELNALKRTEEDLKKGHQKLEEMVTRLDQE Storage and Stability: May be stored at 4C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20C. Aliquots are stable for 12 months after receipt. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
Clonality: Monoclonal
Clone Designation: [5B7]
NCBI: 006283
Purity: Purified.
Form: Supplied as a liquid in PBS, pH 7.4.