DDIT3/CHOP Rabbit pAb, Unconjugated

Product Overview

• Article Name: DDIT3/CHOP Rabbit pAb, Unconjugated
• Biozol Catalog Number: ABB-A0221
• Supplier Catalog Number: A0221
• Alternative Catalog Number: ABB-A0221-100UL,ABB-A0221-20UL,ABB-A0221-1000UL,ABB-A0221-500UL
• Manufacturer: ABclonal
• Host: Rabbit
• Category: Antikörper
• Application: ELISA, IF, IHC-P, WB
• Species Reactivity: Human
• Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
• Conjugation: Unconjugated
• Alternative Names: CHOP, CEBPZ, CHOP10, CHOP-10, GADD153, AltDDIT3, C/EBPzeta, DDIT3/CHOP

Product Description

This gene encodes a member of the CCAAT/enhancer-binding protein (C/EBP) family of transcription factors. The protein functions as a dominant-negative inhibitor by forming heterodimers with other C/EBP members, such as C/EBP and LAP (liver activator protein), and preventing their DNA binding activity. The protein is implicated in adipogenesis and erythropoiesis, is activated by endoplasmic reticulum stress, and promotes apoptosis. Fusion of this gene and FUS on chromosome 16 or EWSR1 on chromosome 22 induced by translocation generates chimeric proteins in myxoid liposarcomas or Ewing sarcoma. Multiple alternatively spliced transcript variants encoding two isoforms with different length have been identified.

Product Properties

• Clonality: Polyclonal
• Molecular Weight: 19kDa
• NCBI: 1649
• UniProt: P35638
• Purity: Affinity purification
• Sequence: MAAESLPFSFGTLSSWELEAWYEDLQEVLSSDENGGTYVSPPGNEEEESKIFTTLDPASLAWLTEEEPEPAEVTSTSQSPHSPDSSQSSLAQEEEEEDQGRTRKRKQSGHSPARAGKQRMKEKEQENERKVAQLAEENERLKQEIERLTREVEATRRALIDRMVNLHQA
• Target: DDIT3
• Antibody Type: Primary Antibody

Application Notes

• Application Dilute: WB,1:1000 - 1:5000|IHC-P,1:50 - 1:200|IF/ICC,1:50 - 1:200|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
• Application Notes: Cross-Reactivity: Human,Mouse,Rat, ResearchArea: Epigenetics Nuclear Signaling,Transcription Factors,Signal Transduction,Cell Biology Developmental Biology,Autophagy,Endocrine Metabolism,Endocrine and metabolic diseases,Diabetes,Obesity,Stem Cells,Embryonic Stem Cells.

Images

Western blot analysis of lysates from C6 cells, using DDIT3/CHOP Rabbit pAb (A0221) at 1:2000 dilution. C6 cells were treated with tunicamycin (2 µg/ml) for 8 hours.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 30s.

Western blot analysis of lysates from C2C12 cells, using DDIT3/CHOP Rabbit pAb (A0221) at 1:1000 dilution. C2C12 cells were treated with tunicamycin (2 µg/ml) for 8 hours.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 30s.

Western blot analysis of various lysates using DDIT3/CHOP Rabbit pAb (A0221) at 1:1000 dilution. C2C12 and C6 cells were treated with tunicamycin (2 µg/ml) for 8 hours.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 30s.

Western blot analysis of lysates from C6 cells, using DDIT3/CHOP Rabbit pAb (A0221) at 1:1000 dilution. C6 cells were treated with tunicamycin (2 µg/ml) for 8 hours.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 30s.

Immunohistochemistry analysis of paraffin-embedded Human esophageal cancer using DDIT3/CHOP Rabbit pAb (A0221) at dilution of 1:100 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate buffer (pH 6.0) prior to IHC staining.

Immunohistochemistry analysis of paraffin-embedded Human liver cancer using DDIT3/CHOP Rabbit pAb (A0221) at dilution of 1:100 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate buffer (pH 6.0) prior to IHC staining.

Immunofluorescence analysis of L929 cells using DDIT3/CHOP Rabbit pAb (A0221) at dilution of 1:100. Blue: DAPI for nuclear staining.

Immunofluorescence analysis of C6 cells using DDIT3/CHOP Rabbit pAb (A0221) at dilution of 1:100. Blue: DAPI for nuclear staining.

Immunofluorescence analysis of U2OS cells using DDIT3/CHOP Rabbit pAb (A0221) at dilution of 1:100. Blue: DAPI for nuclear staining.