VHL Rabbit pAb, Unconjugated

Catalog Number: ABB-A0377
Article Name: VHL Rabbit pAb, Unconjugated
Biozol Catalog Number: ABB-A0377
Supplier Catalog Number: A0377
Alternative Catalog Number: ABB-A0377-100UL,ABB-A0377-20UL,ABB-A0377-500UL,ABB-A0377-1000UL
Manufacturer: ABclonal
Host: Rabbit
Category: Antikörper
Application: ELISA, IF, IHC-P, WB
Species Reactivity: Human
Immunogen: Synthetic peptide. This information is considered to be commercially sensitive.
Conjugation: Unconjugated
Alternative Names: RCA1, VHL1, pVHL, HRCA1, VHL
This gene encodes a component of a ubiquitination complex. The encoded protein is involved in the ubiquitination and degradation of hypoxia-inducible-factor (HIF), which is a transcription factor that plays a central role in the regulation of gene expression by oxygen. In addition to oxygen-related gene expression, this protein plays a role in many other cellular processes including cilia formation, cytokine signaling, regulation of senescence, and formation of the extracellular matrix. Variants of this gene are associated with von Hippel-Lindau syndrome, pheochromocytoma, erythrocytosis, renal cell carcinoma, and cerebellar hemangioblastoma.
Clonality: Polyclonal
Molecular Weight: 24kDa
NCBI: 7428
UniProt: P40337
Purity: Affinity purification
Sequence: VWLNFDGEPQPYPTLPPGTGRRIHSYRGHLWLFRDAGTHDGLLVNQTELFVPSLNVDGQPIFANITLPVYTLKERCLQVVRSLVKPENYRRLDIVRSLYEDLEDHPNVQKDLERLTQERIAHQRMGD
Target: VHL
Antibody Type: Primary Antibody
Application Dilute: WB,1:500 - 1:2000|IHC-P,1:50 - 1:200|IF/ICC,1:50 - 1:200|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Application Notes: Cross-Reactivity: Human,Mouse,Rat, ResearchArea: Epigenetics Nuclear Signaling,Cancer,Tumor suppressors,Cell Biology Developmental Biology,Apoptosis,Cell Cycle,Cell cycle inhibitors,Cell differentiation,Ubiquitin,Ubiquitin-Proteasome Signaling Pathway,Endocrine Metabolism,Immunology Inflammation,Cardiovascular,Angiogenesis.
Immunohistochemistry analysis of paraffin-embedded Human kidney using VHL Rabbit pAb (A0377) at dilution of 1:100 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate buffer (pH 6.0) prior to IHC staining.
Immunofluorescence analysis of U-251 MG cells using VHL Rabbit pAb (A0377) at dilution of 1:100 (40x lens). Secondary antibody: Cy3-conjugated Goat anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.
Western blot analysis of various lysates using VHL Rabbit pAb (A0377) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 30s.