[KD Validated] NF2 Rabbit pAb, Unconjugated

Catalog Number: ABB-A0739
Article Name: [KD Validated] NF2 Rabbit pAb, Unconjugated
Biozol Catalog Number: ABB-A0739
Supplier Catalog Number: A0739
Alternative Catalog Number: ABB-A0739-100UL,ABB-A0739-20UL,ABB-A0739-500UL,ABB-A0739-1000UL
Manufacturer: ABclonal
Host: Rabbit
Category: Antikörper
Application: ELISA, IF, IP, WB
Species Reactivity: Human
Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Conjugation: Unconjugated
Alternative Names: ACN, SCH, BANF, merlin-1, F2
This gene encodes a protein that is similar to some members of the ERM (ezrin, radixin, moesin) family of proteins that link cytoskeletal components with proteins in the cell membrane. The encoded protein is involved in regulation of contact-dependent inhibition of cell proliferation and functions in cell-cell adhesion and transmembrane signaling. The encoded protein has been shown to interact with cell-surface proteins, proteins involved in cytoskeletal dynamics, and proteins involved in regulating ion transport. Disruption of this proteins function has been implicated in tumorigenesis and metastasis. Mutations in this gene are associated with neurofibromatosis type II which is characterized by nervous system and skin tumors and ocular abnormalities.
Clonality: Polyclonal
Molecular Weight: 70kDa
NCBI: 4771
UniProt: P35240
Purity: Affinity purification
Sequence: TKPTYPPMNPIPAPLPPDIPSFNLIGDSLSFDFKDTDMKRLSMEIEKEKVEYMEKSKHLQEQLNELKTEIEALKLKERETALDILHNENSDRGGSSKHNT
Target: NF2
Antibody Type: Primary Antibody
Application Dilute: WB,1:500 - 1:2000|IF/ICC,1:50 - 1:200|IP,0.5µg-4µg antibody for 200µg-400µg extracts of whole cells|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Application Notes: Cross-Reactivity: Human,Mouse,Rat, ResearchArea: Epigenetics Nuclear Signaling,Protein phosphorylation,Cancer,Tumor suppressors,Signal Transduction,Cell Biology Developmental Biology,Cell Adhesion,Neuroscience.
Western blot analysis of lysates from wild type (WT) and NF2 knockdown (KD) HeLa cells using [KD Validated] NF2 Rabbit pAb (A0739) at 1:1000 dilution incubated overnight at 4°C.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25 µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020)
Exposure time: 180 s.
Western blot analysis of various lysates using [KD Validated] NF2 Rabbit pAb (A0739) at 1:1000 dilution incubated overnight at 4°C.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25 µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020)
Exposure time: 30 s.
Western blot analysis of lysates from HepG2 cells, using [KD Validated] NF2 Rabbit pAb (A0739) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 3s.
Western blot analysis of lysates from wild type (WT) and NF2 knockdown (KD) HeLa cells, using [KD Validated] NF2 Rabbit pAb (A0739) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 3s.
Immunofluorescence analysis of C6 cells using [KD Validated] NF2 Rabbit pAb (A0739) at dilution of 1:100. Blue: DAPI for nuclear staining.
Immunofluorescence analysis of L929 cells using [KD Validated] NF2 Rabbit pAb (A0739) at dilution of 1:100. Blue: DAPI for nuclear staining.
Immunofluorescence analysis of U2OS cells using [KD Validated] NF2 Rabbit pAb (A0739) at dilution of 1:100. Blue: DAPI for nuclear staining.
Immunoprecipitation analysis of 200 µg extracts of SKOV3 cells using 3 µg [KD Validated] NF2 Rabbit pAb (A0739). Western blot was performed from the immunoprecipitate using NF2 antibody (A0739) at a dilution of 1:1000.
Immunoprecipitation analysis of 200 µg extracts of A-549 cells using 3 µg [KD Validated] NF2 Rabbit pAb (A0739). Western blot was performed from the immunoprecipitate using [KO Validated] NF2 Rabbit pAb (A0739) at a dilition of 1:1000.