CD74 Rabbit pAb, Unconjugated, Polyclonal

Product Overview

• Article Name: CD74 Rabbit pAb, Unconjugated, Polyclonal
• Biozol Catalog Number: ABB-A24487
• Supplier Catalog Number: A24487
• Alternative Catalog Number: ABB-A24487-20UL,ABB-A24487-100UL,ABB-A24487-1000UL,ABB-A24487-500UL
• Manufacturer: ABclonal
• Host: Rabbit
• Category: Antikörper
• Application: ELISA, WB
• Species Reactivity: Mouse
• Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
• Conjugation: Unconjugated
• Alternative Names: Ii, CLIP, DHLAG, HLADG, Ia-GAMMA, CD74

Product Description

Enables MHC class II protein binding activity, cytokine receptor activity, and nitric-oxide synthase binding activity. Contributes to cytokine binding activity. Involved in several processes, including macrophage migration inhibitory factor signaling pathway, positive regulation of macromolecule metabolic process, and regulation of signal transduction. Acts upstream of or within several processes, including antigen processing and presentation of exogenous peptide antigen via MHC class II, regulation of T cell differentiation, and thymic T cell selection. Located in several cellular components, including Golgi apparatus, external side of plasma membrane, and multivesicular body. Part of MHC class II protein complex, NOS2-CD74 complex, and macrophage migration inhibitory factor receptor complex. Is expressed in lower jaw, lower jaw incisor, lower jaw molar, and thymus primordium. Orthologous to human CD74 (CD74 molecule).

Product Properties

• Clonality: Polyclonal
• Molecular Weight: 24kDa
• NCBI: 16149
• UniProt: P04441
• Purity: Affinity purification
• Sequence: QQQGRLDKLTITSQNLQLESLRMKLPKSAKPVSQMRMATPLLMRPMSMDNMLLGPVKNVTKYGNMTQDHVMHLLTRSGPLEYPQLKGTFPENLKHLKNSMDGVNWKIFESWMKQWLLFEMSKNSLEEKKPTEAPPKEPLDMEDLSSGLGVTRQELGQVTL
• Target: Cd74
• Antibody Type: Primary Antibody

Application Notes

• Application Dilute: WB,1:500 - 1:1000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
• Application Notes: Cross-Reactivity: Mouse. Shipping: Ice Bag

Images

Western blot analysis of lysates from Mouse thymus, using CD74 Rabbit pAb (A24487) at 1:900 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 30s.