Anti-LAMB3 Antibody, Unconjugated, Rabbit, Polyclonal

Catalog Number: ABC-A88170-100
Article Name: Anti-LAMB3 Antibody, Unconjugated, Rabbit, Polyclonal
Biozol Catalog Number: ABC-A88170-100
Supplier Catalog Number: A88170-100
Alternative Catalog Number: ABC-A88170-100
Manufacturer: Antibodies.com
Host: Rabbit
Category: Antikörper
Application: ELISA, WB
Species Reactivity: Human, Rat
Immunogen: A recombinant fusion protein corresponding to amino acids 762-1004 of human LAMB3.
Conjugation: Unconjugated
Rabbit polyclonal antibody to LAMB3.
Clonality: Polyclonal
Concentration: Lot Specific
Molecular Weight: 130 kDa
Buffer: Supplied in Phosphate Buffered Saline, pH 7.3, with 50% Glycerol and 0.05% ProClin 300.
Form: Liquid
Sequence: TGSPKLVALRLEMSSLPDLTPTFNKLCGNSRQMACTPISCPGELCPQDNGTACGSRCRGVLPRAGGAFLMAGQVAEQLRGFNAQLQRTRQMIRAAEESASQIQSSAQRLETQVSASRSQMEEDVRRTRLLIQQVRDFLTDPDTDAATIQEVSEAVLALWLPTDSATVLQKMNEIQAIAARLPNVDLVLSQTKQDIARARRLQAEAEEARSRAHAVEGQVEDVVGNLRQGTVALQEAQDTMQGT
Target: LAMB3
Antibody Type: Primary Antibody
Application Dilute: WB: 1:100-1:500