LAMTOR3 Recombinant Protein (Human)

Catalog Number: ASB-OPCA04786
Article Name: LAMTOR3 Recombinant Protein (Human)
Biozol Catalog Number: ASB-OPCA04786
Supplier Catalog Number: OPCA04786
Alternative Catalog Number: ASB-OPCA04786-100UG, ASB-OPCA04786-1MG, ASB-OPCA04786-20UG
Manufacturer: Aviva
Category: Proteine/Peptide
Species Reactivity: Human
Alternative Names: late endosomal/lysosomal adaptor and MAPK and MTOR activator 3,MAP2K1IP1,MAPBP,MAPK scaffold protein 1,MAPKSP1,MEK binding partner 1,MEK-binding partner 1,mitogen-activated protein kinase kinase 1 interacting protein 1,Mitogen-activated protein kinase kinase 1-interacting protein 1,mitogen-activated protein kinase scaffold protein 1,MP1,PRO0633,ragulator complex protein LAMTOR3,Ragulator3.
As part of the Ragulator complex it is involved in amino acid sensing and activation of mTORC1, a signaling complex promoting cell growth in response to growth factors, energy levels, and amino acids. Activated by amino acids through a mechanism involving the lysosomal V-ATPase, the Ragulator functions as a guanine nucleotide exchange factor activating the small GTPases Rag. Activated Ragulator and Rag GTPases function as a scaffold recruiting mTORC1 to lysosomes where it is in turn activated. Adapter protein that enhances the efficiency of the MAP kinase cascade facilitating the activation of MAPK2.
Molecular Weight: 40.6 kDa
Tag: N-terminal GST-tagged
NCBI: 8649
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Source: E.coli
Purity: Greater than 90% as determined by SDS-PAGE.
Form: Liquid or Lyophilized powder
Sequence: MADDLKRFLYKKLPSVEGLHAIVVSDRDGVPVIKVANDNAPEHALRPGFLSTFALATDQGSKLGLSKNKSIICYYNTYQVVQFNRLPLVVSFIASSSANTGLIVSLEKELAPLFEELRQVVEVS