Anti-LEF1

Catalog Number: ATA-HPA002087
Article Name: Anti-LEF1
Biozol Catalog Number: ATA-HPA002087
Supplier Catalog Number: HPA002087
Alternative Catalog Number: ATA-HPA002087-100,ATA-HPA002087-25
Manufacturer: Atlas Antibodies
Host: Rabbit
Category: Sonstiges
Application: ChIP, ICC, IHC, WB
Species Reactivity: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Conjugation: Unconjugated
Alternative Names: TCF10, TCF1ALPHA, TCF7L3
lymphoid enhancer-binding factor 1
Anti-LEF1
Clonality: Polyclonal
Concentration: 0.1 mg/ml
Isotype: IgG
NCBI: 51176
UniProt: Q9UJU2
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purity: Affinity purified using the PrEST antigen as affinity ligand
Sequence: SDVNSKQGMSRHPPAPDIPTFYPLSPGGVGQITPPLGWQGQPVYPITGGFRQPYPSSLSVDTSMSRFSHHMIPGPPGPHTTGIPHPAIVTPQVKQEHPHTDSDLMHVKPQHEQRKEQEPKRPHIKKPLNAFMLY
Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Target: LEF1
Antibody Type: Monoclonal Antibody
Application Dilute: ICC-IF: 0.25-2 µg/ml, IHC: 1:50 - 1:200, WB: 0.04-0.4 µg/ml
Immunofluorescent staining of human cell line U-251 MG shows localization to nucleoplasm & cytosol.
Immunohistochemical staining of human oral mucosa shows moderate nuclear positivity in subset of squamous epithelial cells.
Immunohistochemical staining of human lymph node shows moderate to strong nuclear positivity in non - germinal center cells.
Western blot analysis in human cell lines SK-MEL-30 and A-549 using Anti-LEF1 antibody. Corresponding LEF1 RNA-seq data are presented for the same cell lines. Loading control: Anti-PPIB.
Western blot analysis in control (vector only transfected HEK293T lysate) and LEF1 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (~3.1 kDa) in mammalian HEK293T cells, LY402529).
HPA002087-100ul
HPA002087-100ul
HPA002087-100ul