Anti-HMGCS2
Catalog Number:
ATA-HPA027423
- Images (11)
| Article Name: | Anti-HMGCS2 |
| Biozol Catalog Number: | ATA-HPA027423 |
| Supplier Catalog Number: | HPA027423 |
| Alternative Catalog Number: | ATA-HPA027423-100,ATA-HPA027423-25 |
| Manufacturer: | Atlas Antibodies |
| Host: | Rabbit |
| Category: | Sonstiges |
| Application: | IHC, WB |
| Species Reactivity: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Conjugation: | Unconjugated |
| Alternative Names: | HMGCS2 |
| 3-hydroxy-3-methylglutaryl-CoA synthase 2 (mitochondrial) |
| Anti-HMGCS2 |
| Clonality: | Polyclonal |
| Concentration: | 0.1 mg/ml |
| Isotype: | IgG |
| NCBI: | 3158 |
| UniProt: | P54868 |
| Buffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Purity: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequence: | ASFFSFRVSQDAAPGSPLDKLVSSTSDLPKRLASRKCVSPEEFTEIMNQREQFYHKVNFSPPG |
| Storage: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target: | HMGCS2 |
| Antibody Type: | Monoclonal Antibody |
| Application Dilute: | IHC: 1:1000 - 1:2500, WB: 0.04-0.4 µg/ml |
|
|
Immunohistochemistry analysis in human liver and cerebral cortex tissues using Anti-HMGCS2 antibody. Corresponding HMGCS2 RNA-seq data are presented for the same tissues. |
|
|
Immunohistochemical staining of human cerebral cortex, kidney, liver and lymph node using Anti-HMGCS2 antibody HPA027423 (A) shows similar protein distribution across tissues to independent antibody HPA027442 (B). |
|
|
Immunohistochemical staining of human cerebral cortex shows low expression as expected. |
|
|
Immunohistochemical staining of human liver shows high expression. |
|
|
Immunohistochemical staining of human lymph node using Anti-HMGCS2 antibody HPA027423. |
|
|
Immunohistochemical staining of human kidney using Anti-HMGCS2 antibody HPA027423. |
|
|
Western blot analysis using Anti-HMGCS2 antibody HPA027423 (A) shows similar pattern to independent antibody HPA027442 (B). |
|
|
HPA027423-100ul |
|
|
|
|
|
HPA027423-100ul |
|
|
HPA027423-100ul |
Product Guarantee and Expert Support
