Anti-SEMA3E, Rabbit, Polyclonal

Product Overview

• Article Name: Anti-SEMA3E, Rabbit, Polyclonal
• Biozol Catalog Number: ATA-HPA029419
• Supplier Catalog Number: HPA029419
• Alternative Catalog Number: ATA-HPA029419-100,ATA-HPA029419-25
• Manufacturer: Atlas Antibodies
• Host: Rabbit
• Category: Antikörper
• Application: IHC
• Species Reactivity: Human, Mouse
• Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
• Conjugation: Unconjugated
• Alternative Names: coll-5, KIAA0331, M-SemaK, SEMAH

Product Description

sema domain, immunoglobulin domain (Ig), short basic domain, secreted, (semaphorin) 3E

Additional Information

Anti-SEMA3E

Product Properties

• Clonality: Polyclonal
• Concentration: 0.1 mg/ml
• Isotype: IgG
• NCBI: 9723
• UniProt: O15041
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
• Purity: Affinity purified using the PrEST antigen as affinity ligand
• Sequence: MDLGLLFLRLHKSDAGTYFCQTVEHSFVHTVRKITLEVVEEEKVEDMFNKDDEEDRHHRMPCPAQSSISQGAKPWYKEFLQLIGYSNFQRVEEYCEKVWCTDRKRKKLKMSPSKWKYANPQEKKLRSKPEHYR
• Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
• Antibody Type: Monoclonal Antibody

Application Notes

• Application Dilute: IHC: 1:200 - 1:500

Images

Immunohistochemical staining of human cerebral cortex shows weak cytoplasmic positivity in neurons.

Immunohistochemical staining of human endometrium shows strong membranous positivity in glandular cells.

Immunohistochemical staining of mouse prostate shows moderate to strong membranous positivity in glandular cells.

Immunohistochemical staining of human skeletal muscle shows no positivity in myocytes as expected.

Immunofluorescence staining of mouse basal forebrain (caudate putamen) shows moderate to strong positivity

Immunofluorescence staining of human midbrain shows moderate to strong positivity of neurons in the dorsal raphe nucleus.

Immunofluorescence staining of human cerebral cortex shows moderate to strong positivity of neurons in the visual cortex.

Immunofluorescence staining of mouse hippocampus shows moderate to strong positivity of neurons in the ca2.

Immunohistochemical staining of mouse hypothalamus shows moderate to strong cytoplasmic positivity in neurons.