Anti-PTH

Catalog Number: ATA-HPA048540
Article Name: Anti-PTH
Biozol Catalog Number: ATA-HPA048540
Supplier Catalog Number: HPA048540
Alternative Catalog Number: ATA-HPA048540-100,ATA-HPA048540-25
Manufacturer: Atlas Antibodies
Host: Rabbit
Category: Sonstiges
Application: IHC
Species Reactivity: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Conjugation: Unconjugated
Alternative Names: PTH1
parathyroid hormone
Anti-PTH
Clonality: Polyclonal
Concentration: 0.1 mg/ml
Isotype: IgG
NCBI: 5741
UniProt: P01270
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purity: Affinity purified using the PrEST antigen as affinity ligand
Sequence: KSVKKRSVSEIQLMHNLGKHLNSMERVEWLRKKLQDVHNFVALGAPLAPRDAGSQRPRKKEDNVLVESHEKSLGEADKADVNVLTKAK
Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Target: PTH
Antibody Type: Monoclonal Antibody
Application Dilute: IHC: 1:1000 - 1:2500
Immunohistochemistry analysis in human parathyroid gland and cervix, uterine tissues using Anti-PTH antibody. Corresponding PTH RNA-seq data are presented for the same tissues.
Immunohistochemical staining of human parathyroid gland shows high expression.
Immunohistochemical staining of human cervix, uterine shows low expression as expected.
HPA048540-100ul
HPA048540-100ul
HPA048540-100ul