Anti-BTBD1, Rabbit, Polyclonal
Catalog Number:
ATA-HPA067671
- Images (6)
| Article Name: | Anti-BTBD1, Rabbit, Polyclonal |
| Biozol Catalog Number: | ATA-HPA067671 |
| Supplier Catalog Number: | HPA067671 |
| Alternative Catalog Number: | ATA-HPA067671-25,ATA-HPA067671-100 |
| Manufacturer: | Atlas Antibodies |
| Host: | Rabbit |
| Category: | Antikörper |
| Application: | IHC |
| Species Reactivity: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Conjugation: | Unconjugated |
| Alternative Names: | BTBD1 |
| BTB (POZ) domain containing 1 |
| Anti-BTBD1 |
| Clonality: | Polyclonal |
| Concentration: | 0.2 mg/ml |
| Isotype: | IgG |
| NCBI: | 53339 |
| UniProt: | Q9H0C5 |
| Buffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Purity: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequence: | SSLGPLLPLQREPLYNWQATKASLKERFAFL |
| Storage: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target: | BTBD1 |
| Antibody Type: | Monoclonal Antibody |
| Application Dilute: | IHC: 1:200 - 1:500 |
|
|
Immunohistochemistry analysis in human skeletal muscle and pancreas tissues using Anti-BTBD1 antibody. Corresponding BTBD1 RNA-seq data are presented for the same tissues. |
|
|
Immunohistochemical staining of human skeletal muscle shows high expression. |
|
|
Immunohistochemical staining of human pancreas shows low expression as expected. |
|
|
HPA067671 |
|
|
HPA067671 |
|
|
HPA067671 |
Product Guarantee and Expert Support
