Recombinant Human Somatostatin receptor type 2 (SSTR2) -VLPs , Active Protein, Unconjugated, Mammal

Product Overview

• Article Name: Recombinant Human Somatostatin receptor type 2 (SSTR2) -VLPs , Active Protein, Unconjugated, Mammal
• Biozol Catalog Number: BIM-RPC29776
• Supplier Catalog Number: RPC29776
• Alternative Catalog Number: BIM-RPC29776-20UG,BIM-RPC29776-100UG,BIM-RPC29776-1MG
• Manufacturer: Biomatik Corporation
• Host: Mammal
• Category: Proteine/Peptide
• Species Reactivity: Human
• Conjugation: Unconjugated
• Alternative Names: SSTR2, Somatostatin receptor type 2, SS-2-R, SS2-R, SS2R, SRIF-1

Product Description

Accession Number: P30874; SSTR2. Activity: Biologically Active. Endotoxin Level: <1.0 EU/ug, by LAL method. Expiration: 12 months. Expression Region: 1-369aa. Protein Length: Full Length. Protein Type: MP-VLP Transmembrane Protein; Active Protein. Quality Guarantee: This product carries the Biomatik 100% Quality Guarantee. Please refer to the Terms and Conditions for details. Quality Systems: This product is manufactured at ISO 9001 certified facilities. Reconstitution: Refer to the datasheet/CoA included in the product pouch. Research Area: Cancer. Shipping Condition: Ice packs. Short Description: Recombinant Human Somatostatin receptor type 2 (SSTR2) -VLPs , Active Protein is a purified MP-VLP Transmembrane Protein; Active Protein

Product Properties

• Molecular Weight: 42.5kDa
• Tag: C-Terminal 6xHis-Tagged (This tag can be tested only under denaturing conditions)
• Purity: The purity information is not available for VLPs proteins
• Sequence: MDMADEPLNGSHTWLSIPFDLNGSVVSTNTSNQTEPYYDLTSNAVLTFIYFVVCIIGLCGNTLVIYVILRYAKMKTITNIYILNLAIADELFMLGLPFLAMQVALVHWPFGKAICRVVMTVDGINQFTSIFCLTVMSIDRYLAVVHPIKSAKWRRPRTAKMITMAVWGVSLLVILPIMIYAGLRSNQWGRSSCTINWPGESGAWYTGFIIYTFILGFLVPLTIICLCYLFIIIKVKSSGIRVGSSKRKKSEKKV
• Target: Somatostatin receptor type 2 (SSTR2) -VLPs