Recombinant Human Tenascin (TNC), partial, Unconjugated, E. coli

Product Overview

• Article Name: Recombinant Human Tenascin (TNC), partial, Unconjugated, E. coli
• Biozol Catalog Number: BIM-RPC29778
• Supplier Catalog Number: RPC29778
• Alternative Catalog Number: BIM-RPC29778-20UG,BIM-RPC29778-100UG,BIM-RPC29778-1MG
• Manufacturer: Biomatik Corporation
• Host: E. coli
• Category: Proteine/Peptide
• Species Reactivity: Human
• Conjugation: Unconjugated
• Alternative Names: Cytotactin, GMEMGP 150-225Glioma-associated-Extracellular domain matrix antigenHexabrachionJIMyotendinous antigenNeuronectin, Tenascin-C, TN-C

Product Description

Accession Number: P24821; TNC. Activity: Not Tested. Endotoxin Level: Not Tested. Expiration: 12 months. Expression Region: 1888-2201aa. Protein Length: Partial. Protein Type: Recombinant Protein. Quality Guarantee: This product carries the Biomatik 100% Quality Guarantee. Please refer to the Terms and Conditions for details. Quality Systems: This product is manufactured at ISO 9001 certified facilities. Reconstitution: Refer to the datasheet/CoA included in the product pouch. Research Area: Signal Transduction. Shipping Condition: Ice packs. Short Description: Recombinant Human Tenascin (TNC), partial is a purified Recombinant Protein

Product Properties

• Molecular Weight: 39.5kDa
• Tag: N-Terminal 6xHis-Tagged
• Purity: >90% by SDS-PAGE
• Sequence: DSPRDLTATEVQSETALLTWRPPRASVTGYLLVYESVDGTVKEVIVGPDTTSYSLADLSPSTHYTAKIQALNGPLRSNMIQTIFTTIGLLYPFPKDCSQAMLNGDTTSGLYTIYLNGDKAEALEVFCDMTSDGGGWIVFLRRKNGRENFYQNWKAYAAGFGDRREEFWLGLDNLNKITAQGQYELRVDLRDHGETAFAVYDKFSVGDAKTRYKLKVEGYSGTAGDSMAYHNGRSFSTFDKDTDSAITNCALSYK
• Target: Tenascin (TNC)