Recombinant Human Selenoprotein P (SELENOP, U59S,U300S,U318S,U330S,U345S,U352S,U367S,U369S,U376S,U378S), Unconjugated, Yeast

Product Overview

• Article Name: Recombinant Human Selenoprotein P (SELENOP, U59S,U300S,U318S,U330S,U345S,U352S,U367S,U369S,U376S,U378S), Unconjugated, Yeast
• Biozol Catalog Number: BIM-RPC29780
• Supplier Catalog Number: RPC29780
• Alternative Catalog Number: BIM-RPC29780-20UG,BIM-RPC29780-100UG,BIM-RPC29780-1MG
• Manufacturer: Biomatik Corporation
• Host: Yeast
• Category: Proteine/Peptide
• Species Reactivity: Human
• Conjugation: Unconjugated
• Alternative Names: Selenoprotein P, Selenoprotein P plasma 1, Selp, SeP, Sepp1, SEPP1_HUMAN

Product Description

Accession Number: P49908; SELENOP. Activity: Not Tested. Endotoxin Level: Not Tested. Expiration: 12 months. Expression Region: 20-381aa(U59S,U300S,U318S,U330S,U345S,U352S,U367S,U369S,U376S,U378S). Protein Length: Full Length of Mature Protein. Protein Type: Recombinant Protein. Quality Guarantee: This product carries the Biomatik 100% Quality Guarantee. Please refer to the Terms and Conditions for details. Quality Systems: This product is manufactured at ISO 9001 certified facilities. Reconstitution: Refer to the datasheet/CoA included in the product pouch. Research Area: Others. Shipping Condition: Ice packs. Short Description: Recombinant Human Selenoprotein P (SELENOP; U59S,U300S,U318S,U330S,U345S,U352S,U367S,U369S,U376S,U378S) is a purified Recombinant Protein

Product Properties

• Molecular Weight: 42.6kDa
• Tag: N-Terminal 6xHis-Tagged
• Purity: >90% by SDS-PAGE
• Sequence: ESQDQSSLCKQPPAWSIRDQDPMLNSNGSVTVVALLQASSYLCILQASKLEDLRVKLKKEGYSNISYIVVNHQGISSRLKYTHLKNKVSEHIPVYQQEENQTDVWTLLNGSKDDFLIYDRCGRLVYHLGLPFSFLTFPYVEEAIKIAYCEKKCGNCSLTTLKDEDFCKRVSLATVDKTVETPSPHYHHEHHHNHGHQHLGSSELSENQQPGAPNAPTHPAPPGLHHHHKHKGQHRQGHPENRDMPASEDLQDLQ
• Target: Selenoprotein P (SELENOP, U59S,U300S,U318S,U330S,U345S,U352S,U367S,U369S,U376S,U378S)