Recombinant Human Testisin (PRSS21), Unconjugated, E. coli

Catalog Number: BIM-RPC29789
Article Name: Recombinant Human Testisin (PRSS21), Unconjugated, E. coli
Biozol Catalog Number: BIM-RPC29789
Supplier Catalog Number: RPC29789
Alternative Catalog Number: BIM-RPC29789-20UG,BIM-RPC29789-100UG,BIM-RPC29789-1MG
Manufacturer: Biomatik Corporation
Host: E. coli
Category: Proteine/Peptide
Species Reactivity: Human
Conjugation: Unconjugated
Alternative Names: Eosinophil serine protease 1
Accession Number: Q9Y6M0; PRSS21. Activity: Not Tested. Endotoxin Level: Not Tested. Expiration: 12 months. Expression Region: 42-288aa. Protein Length: Full Length of Mature Protein. Protein Type: Recombinant Protein. Quality Guarantee: This product carries the Biomatik 100% Quality Guarantee. Please refer to the Terms and Conditions for details. Quality Systems: This product is manufactured at ISO 9001 certified facilities. Reconstitution: Refer to the datasheet/CoA included in the product pouch. Research Area: Cancer. Shipping Condition: Ice packs. Short Description: Recombinant Human Testisin (PRSS21) is a purified Recombinant Protein
Molecular Weight: 31.8kDa
Tag: N-Terminal 6xHis-Tagged
Purity: >90% by SDS-PAGE
Sequence: IVGGEDAELGRWPWQGSLRLWDSHVCGVSLLSHRWALTAAHCFETYSDLSDPSGWMVQFGQLTSMPSFWSLQAYYTRYFVSNIYLSPRYLGNSPYDIALVKLSAPVTYTKHIQPICLQASTFEFENRTDCWVTGWGYIKEDEALPSPHTLQEVQVAIINNSMCNHLFLKYSFRKDIFGDMVCAGNAQGGKDACFGDSGGPLACNKNGLWYQIGVVSWGVGCGRPNRPGVYTNISHHFEWIQKLMAQS
Target: Testisin (PRSS21)