OMA1 Rabbit Polyclonal Antibody, Unconjugated

Catalog Number: BYT-ORB581846
Article Name: OMA1 Rabbit Polyclonal Antibody, Unconjugated
Biozol Catalog Number: BYT-ORB581846
Supplier Catalog Number: orb581846
Alternative Catalog Number: BYT-ORB581846-100
Manufacturer: Biorbyt
Host: Rabbit
Category: Antikörper
Application: WB
Species Reactivity: Human
Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human OMA1
Conjugation: Unconjugated
Alternative Names: DAB1, MPRP1, MPRP-1, YKR087C, ZMPOMA1, peptidase, 2010001O09Rik
Rabbit polyclonal antibody to OMA1
Clonality: Polyclonal
Concentration: 0.5 mg/ml
Molecular Weight: 60 kDa
NCBI: 660286
UniProt: Q96E52
Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Form: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence: Synthetic peptide located within the following region: WAICPRDSLALLCQWIQSKLQEYMFNRPYSRKLEAEADKIGLLLAAKACA
Target: OMA1
Sample Type: HepG2 cells, Primary dilution: 1:1000, Secondary Antibody: anti-Rabbit TBST with 5% BSA, Secondary dilution: 1:5000.
Sample Tissue: Human 786-0 Whole Cell, Antibody dilution: 3 ug/ml.
Sample Tissue: Human HT1080 Whole Cell, Antibody dilution: 1 ug/ml.
Sample Tissue: Human Lung Tumor, Antibody dilution: 1 ug/ml.
Positive control (+): 293T (2T), Negative control (-): Lung tumor (T-LU), Antibody concentration: 5 ug/ml.
Lanes: Lane 1: 10 ug human fibroblast mitochondria, Lane 2: 15 ug fish embryo lysate, 6 h post fertilization, Lane 3: 30 ug fish embryo lysate, 6 days, Primary Antibody dilution: 1:1000, Secondary Antibody: Anti-Rabbit HRP, Secondary Antibody dilution: 1:5000, Gene Name: OMA1.
Surface Plasmon Resonance Kinetic Characterization of Polyclonal Antibody Affinity. Purified polyclonal antibodies were immobilized on a Protein A/G coated Carterra LSA sensor chip (PAGH200M) at concentrations of 5, and 50 ug/ml in duplicate. Antibodies on the surface were exposed to interaction with peptides sequentially via microfluidic controlled flow at 333nM peptide concentration for kinetic characterization of the binders for affinity and specificity, followed by curve fitting using the Kinetics software. Kd determinations for both concentrations were averaged and results and standard deviation are shown.
WB Suggested Anti-OMA1 Antibody Titration: 0.2-1 ug/ml, Positive Control: 721_B cell lysate.