PbpD, Recombinant, Bacillus Subtilis, aa213-450, His-SUMO-Tag (Penicillin-binding Protein 4)

Product Overview

• Article Name: PbpD, Recombinant, Bacillus Subtilis, aa213-450, His-SUMO-Tag (Penicillin-binding Protein 4)
• Biozol Catalog Number: USB-370737
• Supplier Catalog Number: 370737
• Alternative Catalog Number: USB-370737-20,USB-370737-100
• Manufacturer: US Biological
• Category: Molekularbiologie

Product Description

Preferential cleavage: Ac2-L-Lys-D-Ala-|-D-Ala. Also transpeptidation of peptidyl-alanyl moieties that are N-acyl substituents of D-alanine. Source: Partial recombinant protein corresponding to aa213-450 from Bacillus subtilis PbpD, fused to His-SUMO-Tag at N-terminal, expressed in E. coli. Molecular Weight: ~43kD Amino Acid Sequence: PNNPTLYDPLKHFDYTKSRQERLLKGLKDAGVITDKELKKAVKQKIKLDVEKREDKYPDYVSYVNDEFTQLVSESEGFDKRLQKASGKQKEKIENELSARVSTLMKDGVKIYTALDPYMQNQVVAQMNSKLPYADVQGGAAVINHQTHQIIALSGGKNYQKYDFNRAYQAYRQPGSSIKPLLDYGPYIEQTGATTSSTIDASKFCSKDYCPQNYNNRTYGTVTLDTAFKNSYNTPAIR Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.

Product Properties

• Molecular Weight: 43
• UniProt: P40750
• Purity: 90% (SDS-PAGE)
• Form: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.