CLIC4, Recombinant, Human, aa1-253, GST-Tag (Chloride Intracellular Channel Protein 4)

Product Overview

• Article Name: CLIC4, Recombinant, Human, aa1-253, GST-Tag (Chloride Intracellular Channel Protein 4)
• Biozol Catalog Number: USB-372787
• Supplier Catalog Number: 372787
• Alternative Catalog Number: USB-372787-20,USB-372787-100,USB-372787-1
• Manufacturer: US Biological
• Category: Molekularbiologie

Product Description

Can insert into membranes and form poorly selective ion channels that may also transport chloride ions. Channel activity depends on the pH. Membrane insertion seems to be redox-regulated and may occur only under oxydizing conditions. Promotes cell-surface expression of HRH3. Has alternate cellular functions like a potential role in angiogenesis or in maintaining apical-basolateral membrane polarity during mitosis and cytokinesis. Could also promote endothelial cell proliferation and regulate endothelial morphogenesis (tubulogenesis). Source: Recombinant protein corresponding to aa1-253 from human CLIC4, fused to GST-Tag at N-terminal, expressed in E. coli. Molecular Weight: ~55.8kD Amino Acid Sequence: MALSMPLNGLKEEDKEPLIELFVKAGSDGESIGNCPFSQRLFMILWLKGVVFSVTTVDLKRKPADLQNLAPGTHPPFITFNSEVKTDVNKIEEFLEEVLCPPKYLKLSPKHPESNTAGMDIFAKFSAYIKNSRPEANEALERGLLKTLQKLDEYLNSPLPDEIDENSMEDIKFSTRKFLDGNEMTLADCNLLPKLHIVKVVAKKYRNFDIPKEMTGIWRYLTNAYSRDEFTNTCPSDKEVEIAYSDVAKRLTK Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.

Product Properties

• Molecular Weight: 55.8
• UniProt: Q9Y696
• Purity: 90% (SDS-PAGE)
• Form: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.