CRADD, Recombinant, Human, aa1-199, His-SUMO-Tag (Death Domain-containing Protein CRADD)

Product Overview

• Article Name: CRADD, Recombinant, Human, aa1-199, His-SUMO-Tag (Death Domain-containing Protein CRADD)
• Biozol Catalog Number: USB-372860
• Supplier Catalog Number: 372860
• Alternative Catalog Number: USB-372860-20,USB-372860-100,USB-372860-1
• Manufacturer: US Biological
• Category: Molekularbiologie

Product Description

Apoptotic adaptor molecule specific for caspase-2 and FASL/TNF receptor-interacting protein RIP. In the presence of RIP and TRADD, CRADD recruits caspase-2 to the TNFR-1 signalling complex. Source: Recombinant protein corresponding to aa1-99 from human Death Domain-containing Protein CRADD fused to His-SUMO-Tag at N-terminal expressed in E. coli. Molecular Weight: ~38.7kD Amino Acid Sequence: MEARDKQVLRSLRLELGAEVLVEGLVLQYLYQEGILTENHIQEINAQTTGLRKTMLLLDILPSRGPKAFDTFLDSLQEFPWVREKLKKAREEAMTDLPAGDRLTGIPSHILNSSPSDRQINQLAQRLGPEWEPMVLSLGLSQTDIYRCKANHPHNVQSQVVEAFIRWRQRFGKQATFQSLHNGLRAVEVDPSLLLHMLE Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.

Product Properties

• Molecular Weight: 38.7
• UniProt: P78560
• Purity: 90% (SDS-PAGE)
• Form: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.