ZapA, Recombinant, Bacillus pumilus, aa1-85, His-SUMO-Tag (Cell Division Protein ZapA)

Catalog Number: USB-375902
Article Name: ZapA, Recombinant, Bacillus pumilus, aa1-85, His-SUMO-Tag (Cell Division Protein ZapA)
Biozol Catalog Number: USB-375902
Supplier Catalog Number: 375902
Alternative Catalog Number: USB-375902-20, USB-375902-100
Manufacturer: US Biological
Category: Molekularbiologie
Activator of cell division through the inhibition of FtsZ GTPase activity, therefore promoting FtsZ assembly into bundles of protofilaments necessary for the formation of the division Z ring. It is recruited early at mid-cell but it is not essential for cell division. Source: Recombinant protein corresponding to aa1-85 from bacillus pumilus zapA, fused to His-SUMO-Tag at N-terminal expressed in E. coli. Molecular Weight: ~25.9kD Amino Acid Sequence: MSDGGKTKTTVEIYGQSYTIIGQETKMHMRHVASIVDDKMREINEKNPYLDINKLAVLTAVNVVHDYLKLKEQYEKLEIQLKEKE Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Molecular Weight: 25.9
UniProt: A8FG14
Purity: 90% (SDS-PAGE)
Form: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.