Bone Morphogenetic Protein 3, Recombinant, Human, aa363-472, His-Tag, Myc-Tag

Catalog Number: USB-583814
Article Name: Bone Morphogenetic Protein 3, Recombinant, Human, aa363-472, His-Tag, Myc-Tag
Biozol Catalog Number: USB-583814
Supplier Catalog Number: 583814
Alternative Catalog Number: USB-583814-20,USB-583814-100
Manufacturer: US Biological
Category: Molekularbiologie
Growth factor of the TGF-beta superfamily that plays an essential role in developmental process by inducing and patterning early skeletal formation and by negatively regulating bone density. Antagonizes the ability of certain osteogenic BMPs to induce osteoprogenitor differentitation and ossification. Initiates signaling cascades by associating with type II receptor ACVR2B to activate SMAD2-dependent and SMAD-independent signaling cascades including TAK1 and JNK pathways. Source: Recombinant protein corresponding to aa363-472 from human Bone morphogenetic protein 3, fused to 10X His-Tag at N-terminal and Myc-Tag at C-terminal, expressed in Yeast. Molecular Weight: ~16.4kD Amino Acid Sequence: QWIEPRNCARRYLKVDFADIGWSEWIISPKSFDAYYCSGACQFPMPKSLKPSNHATIQSIVRAVGVVPGIPEPCCVPEKMSSLSILFFDENKNVVLKVYPNMTVESCACR Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Molecular Weight: 16.4
UniProt: P12645
Purity: 85% (SDS-PAGE)
Form: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.