Colicin-E5, Recombinant, E. coli, aa74-180, His-SUMO-Tag

Catalog Number: USB-584037
Article Name: Colicin-E5, Recombinant, E. coli, aa74-180, His-SUMO-Tag
Biozol Catalog Number: USB-584037
Supplier Catalog Number: 584037
Alternative Catalog Number: USB-584037-20,USB-584037-100
Manufacturer: US Biological
Category: Molekularbiologie
Colicins are polypeptide toxins produced by and active against E.coli and closely related bacteria. This colicin is an endonuclease. Partial recombinant protein corresponding to aa74-180 from Escherichia coli Colicin-E5, fused to 6X His-SUMO-Tag at N-terminal, expressed in E.coli. Swiss/Uniprot Accession: P18000 Molecular Weight: ~24.8kD Amino Acid Sequence: LAKNKGKIPGLKIDQKIRGQMPERGWTEDDIKNTVSNGATGTSFDKRSPKKTPPDYLGRNDPATVYGSPGKYVVVNDRTGEVTQISDKTDPGWVDDSRIQWGNKNDQ Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Molecular Weight: 24.8
UniProt: P18000
Purity: 85% (SDS-PAGE)
Form: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.