Protein A27, Recombinant, Vaccinia virus, aa1-110, His-Tag, Myc-Tag

Catalog Number: USB-585929
Article Name: Protein A27, Recombinant, Vaccinia virus, aa1-110, His-Tag, Myc-Tag
Biozol Catalog Number: USB-585929
Supplier Catalog Number: 585929
Alternative Catalog Number: USB-585929-20, USB-585929-100
Manufacturer: US Biological
Category: Molekularbiologie
Structural protein involved in the envelopment of mature virion (MV) to form the wrapped virion (WV). The wrapping consists of the addition of Golgi membranes to the mature virion. Participates in mature virion (MV) movement within the infected cell. May play an indirect role in MV-cell fusion. Source: Recombinant protein corresponding to aa1-110 from Vaccinia virus Protein A27, fused to 10X His-Tag at N-terminal and Myc-Tag at C-terminal, expressed in E.coli. Molecular Weight: ~17.6kD Amino Acid Sequence: MDGTLFPGDDDLAIPATEFFSTKAAKKPEAKREAIVKADEDDNEETLKQRLTNLEKKITNVTTKFEQIEKCCKRNDEVLFRLENHAETLRAAMISLAKKIDVQTGRRPYE Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Molecular Weight: 17.6
UniProt: P11258
Purity: 85% (SDS-PAGE)
Form: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.